For quotations, please use our online quotation form, and you may also contact us by
service@kendallscientific.com
+1-888.733.6849 (Toll-free)
+1-617.299.7367 (Int’l))
+1-888.733.6849
Our customer service representatives are available 24 hours, Monday through Friday to assist you.| Introduction | Syndecan-4 is a type I integral membrane heparan sulfate proteoglycan (HSPG), which was originally isolated from cloned rat microvascular endothelial cells as an antithrombin-binding molecule, and is now known to be a member of the syndecan family. Syndecan-4 binds to basic fibroblast growth factor (bFGF), midkine, and tissue factor pathway inhibitor via its heparan sulfate chains, and is thoµght to be involved in various biologic functions such as signaling of bFGF, anticoagulation, and focal adhesion formation. A previous study demonstrated that syndecan-4 is expressed in various tissues, and its level of expression in the kidney is stronger than those of other syndecan family members. Thus, syndecan-4 is thoµght to play certain roles in maintaining renal function. Moreover, it has been reported that proteoglycans, especially sulfated proteoglycans, are involved in organogenesis of the kidney. |
| Synonyms | SDC4, SYND4, SYND-4, Amphiglycan, Ryudocan core protein, Syndecan-4. |
| Source | Escherichia Coli. |
| Physical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation | The SDC4 (1 mg/ml) was lyophilized after extensive dialyses against 20mM PBS pH-7.4. |
| Solubility | It is recommended to reconstitute the lyophilized SDC4 in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. |
| Stability | Lyophilized SDC4 althoµgh stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution SDC4 should be storedat 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Amino Acid Sequence | MASIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTEVLALEHHHHHH. |
| Purity | Greater than 95.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Usage | NeoBiolab's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drµgs, agricultural or pesticidal products, food additives or household chemicals. |
N/A
N/A